10 Best Meal Planning Apps in 2025: The Ultimate Comparison Guide
Looking for the best meal planning app in 2025? We tested and compared 10 top options including Flamyay, Mealime, Paprika, and more.
Read more →
Take meal planning off your plate—deliciously easy
Personalised meal planning, smart price comparison, grocery delivery and all your favourite recipes in one place.
EatingEatingwellwellshouldn'tshouldn'tfeelfeellikelikeaachore.chore.EndlessEndlessscrollingscrollingthroughthroughmaddeningmaddeningad-riddenad-riddenreciperecipewebsites,websites,scribblingscribblingdowndownshoppingshoppinglists,lists,andandtrawlingtrawlingbusybusyaislesaislesforforingredients.ingredients.It'sIt's2025.2025.WhyWhyisn'tisn'ttherethereaabetterbetterway?way?FlamyayFlamyaylearnslearnswhatwhatyouyoulike,like,createscreatesdeliciousdeliciousweeklyweeklymealmealplansplansforforthethewholewholefamily,family,andanddeliversdeliversfreshfreshingredientsingredientsfromfromyouryourfavouritefavouritesupermarketssupermarketsdirectlydirectlytotoyouryourdoor.door.
Groceries and prices from the stores you already know
How Flamyay works
From plan to plate in 4 easy steps
1
Tell us about you
Share your dietary preferences, restrictions, household size, and cooking habits. Whether you're keto, vegetarian, have allergies, want to eat more protein, or just really hate broccoli—we've got you covered!
2
Personalised meal plans
Choose your meals or let us automatically create a plan you'll love. Explore our diverse selection of recipes and import the ones you already know and love from anywhere. You're in control, as much or as little as you like.
3
Smart shopping, easy ordering
Receive an automated shopping list with real-time supermarket price comparisons, so you always get the best deal. Then, relax as groceries are delivered directly to your door or collect them in-store if you prefer.
4
Cook, eat, and enjoy!
Experience the joy of cooking delicious, healthy meals with easy-to-follow recipes suited for all skill levels and schedules. Less time worrying about meals, more time enjoying them
From the Chef's Blog
Tips, guides, and delicious inspiration to help you eat well and save time.
Top 10 High-Protein Recipes for Muscle Building
Build muscle and stay satisfied with these delicious high-protein recipes perfect for fitness enthusiasts.
Read more →Top 10 High-Fiber Recipes for Digestive Health
Boost your digestive health with these fibre-rich recipes that are as delicious as they are nutritious.
Read more →